PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23310.2.p
Common NameBRADI_2g23310, LOC100842747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 602aa    MW: 66454.9 Da    PI: 7.8157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23310.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-1758104148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEde l +av  + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Bradi2g23310.2.p  58 KGGWTPEEDETLRKAVYAFKGKNWKKIAESFP-DRTEVQCLHRWQKVL 104
                       688*****************************.************986 PP

2Myb_DNA-binding605.3e-19110156148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd  ++d vk++G++ W++Ia+ +  gR +kqc++rw+++l
  Bradi2g23310.2.p 110 KGPWTQEEDNTIIDMVKKHGPRKWSLIAKSLD-GRIGKQCRERWHNHL 156
                       79******************************.*************97 PP

3Myb_DNA-binding60.14.7e-19162204145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WTteE++ lv+a+++ G++ W+ Ia+ ++ gRt++++k++w+
  Bradi2g23310.2.p 162 KEAWTTEEEQVLVKAHHLNGNR-WAEIAKLLP-GRTDNSIKNHWN 204
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.71153104IPR017930Myb domain
SMARTSM007171.1E-1457106IPR001005SANT/Myb domain
PfamPF002492.0E-1558104IPR001005SANT/Myb domain
SuperFamilySSF466892.15E-1559114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2260116IPR009057Homeodomain-like
CDDcd001672.73E-1361104No hitNo description
PROSITE profilePS5129431.687105160IPR017930Myb domain
SuperFamilySSF466891.1E-30107203IPR009057Homeodomain-like
SMARTSM007174.4E-17109158IPR001005SANT/Myb domain
PfamPF002491.9E-17110156IPR001005SANT/Myb domain
CDDcd001671.29E-15112156No hitNo description
Gene3DG3DSA:1.10.10.601.7E-26117162IPR009057Homeodomain-like
PROSITE profilePS5129422.686161211IPR017930Myb domain
SMARTSM007172.0E-16161209IPR001005SANT/Myb domain
PfamPF002497.9E-17162205IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-22163210IPR009057Homeodomain-like
CDDcd001674.14E-13164204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MGAMKVEERG GCTENRQHLA LSSPSASEGG GYGGLAGMSP ADSISGRRRT SGPVRRAKGG  60
WTPEEDETLR KAVYAFKGKN WKKIAESFPD RTEVQCLHRW QKVLDPELIK GPWTQEEDNT  120
IIDMVKKHGP RKWSLIAKSL DGRIGKQCRE RWHNHLDPQI RKEAWTTEEE QVLVKAHHLN  180
GNRWAEIAKL LPGRTDNSIK NHWNSSVRKR VEDYNNRVGM PVPQHAIHND LKHAAKLPPA  240
DNHIDLTKEQ SISLKDHMVI VDHSDAIQSP PVCCFKNIKG CSGFLSLSMP TAQPVTLYKT  300
SVSDDSAVAL GIMGLKMDSG HDKDMELKFV SEKGLAINLP NEKSPEIDLI TDKMGPSGLA  360
KSEGETANII CESPSQNEAR SFGSLCYLIP TQDDTDLARS PVFSTHHVRE HCGIGFQSPT  420
GYSTPSPRDG KKSNHLSVES ILRSAAENFP STPSILRRRK REKPTPAQDC ELRIDTNSDS  480
FETPIGNFTT DSPHSFKTAT LLSLGHLDDQ KLPAALGKFD VSPSYRLKSK RMAVLKTIEK  540
HLDFSSDAMD IYDSAGVLKS ACLSSESINS STDNSSVQDK KMGDHMIGLE TPTNDFVHKA  600
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-70572115159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-70572115159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1456463RRRKREKP
2457462RRKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3635121e-158AK363512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568308.10.0PREDICTED: uncharacterized protein LOC100842747
TrEMBLA0A0Q3G3R20.0A0A0Q3G3R2_BRADI; Uncharacterized protein
STRINGBRADI2G23310.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.22e-95myb domain protein 3r-5